Christy Turlington (@cturlington) — Instagram activity
@cturlington
Mother, Wife, Daughter, Sister, Advocate & Founder of @everymomcounts Please join me to make pregnancy & childbirth safe for everyone, everywhere 🇸🇻
- Followers: 1547537
- Likes: 624
- Follows: 65
- Unfollows: 24
thesundaypaperkffhealthnewssarahhoovthemothersofgynecologyeverymomcountsmichaelangelnyckarlamartinezdesalasgene.krellalexwhiteeditsjosieboraincarmen.busquetsmomsfirstusmclean.mcgownnewyorkermagkimchimccartyanushayhossainsammcknight1peterkagantherealnicolettasantoroactivistmonicaramirezkelley.johnsonbirthcenterequitybce__nitchamygriffinshannonrwattsamyswiftcrosbycareylowellceramicspoojalakshminelliebaeeeeeeanjalikumardarrenwalkermyrahpenalozasacredgeometrydomehomejennylandeydoubleagenteddiesternitsclaireaddisonsophy_robertsluna_zorroguardianthemamafestocyanmogijanetribecafeedgeneealyse_cleithclarkjayshettyyemchukaijenpthirsty_burlingtonsharonvanhalenharwellgodfreyamandacbrooksiamavotercameron.grace.cartertina_lutzmorrisfernmallisfameafricacedricsmithstudiograceleekellumnancylorenzstudiomaria_mcmanus_vivianesassenstudiojamaabirthvillageacog_orgjuliedelibranindiawhiskerofficialelaineirwinanhduongartscottschumakerstylevousplaitandreeadiddykianevonmpalomabaygualsophiebolvaryprinceaus.noraianmarkus_wolfferestatestables2thelimits.cothevaleriejunebakeycakesdarabrattmanonbennnorthoverdiarybpfallonchristianelemieuxsasadimaggierizersergenormantlornasimpsonchamberofmothersmissmeiksmatthew_yokoboskyceciliachancellorjuliendyscameronrusselldominowhiskerkathydduglindonnakaranthewomantiinalaakkonenrrichnycmadwillinggavin_fridayerinoconnortedpnemcovakksidedishturshenpaolamendozatootiethetightropewalkershilparshahmarygreenwelljenniferaakerjamespscullyroxanneassoulinsumnermickeyisabelle.townsendgraciebrnsjillsorensennoonasmithpetersenlouie_chabanlisaeisnerjewelrywilliamnorwich__jennifersiebelnewsomsallysargoodmyfairmomoscarbarbariammarpessaclarahranekgueystaraliblackbirdgaryjermynnickdorazioccmeyerdrleskorodmanprimackpregnancyjustokbirthequitythe.holistic.psychologistluciedelafalaisethetidalisttiffaniedebartolofoundraehenryleutwylerfaridakhelfarosemaryferguson_masonlaneericachidiwomenshistoryjoannaczechofficialthisismariamckeekimberlydurdinvanessacornelljimmypaulhairstaleywisegallerylaurabaileylondonkmblodgettlifewaykefirdrkristinlyerlymojestellelefebure_orahewomen_deliverdesigningmotherhoodbiancamaiocchidomesticworkersjoeywolfferiburobinshindyjoiamjenniejosephlizzieswansonprunelisarobinsonnycgenevievejrothjameskaliardostaprootbirththekarayoungbailey_studiolianlunsonmujerxsrisingmarieworsaaekatetparkerhairbychristiaansuzannedoylesdcchelseamcsunshinebettywilkinson281danielaghionebonettialysiamontanomanuelsantelicesfordfoundationlarissa111nytstylerealmiafarrowforallmothersorgmamababyhaitimoyramulholland
thepaigemonroedalyanycheatherlangmycoskiereinahontsoliviagbergerdefuriaresist45ideologydavidlynchtheater1jimmyminardi
inspiredcapitaladdisonmiaaamackburnzparker_burnzzmaggiefarley_diegoosorio1ruby.pdxsophia_lehmann_kevingissmagnuslansingkarenbmacharpervedder
Health and fitness Possibly focused on personal wellness and physical health, potentially indicative of a disciplined and proactive approach to health and wellness. Cannot determine solely based on interest in health and fitness; typically, interests in these areas don't explicitly imply a high level of wealth. None Interest in health and fitness might imply some level of education, either formal or self-taught, in topics related to personal well-being and physical fitness. None <post|>How do you balance your diet and fitness schedule? <post|>, <post|>Are there any fitness influencers or trainers who really motivate you? <post|>, <post|>What inspired you to start focusing on health and fitness? <post|>, <post|>Have you tried any interesting or unusual sports recently? <post|>, <post|>What are your fitness goals for this year? <post|>, <post|>Do you have any favorite fitness routines or workouts that you can recommend? <post|>, <post|>What music do you like to listen to during your workouts to keep you pumped? <post|>, <post|>Do you prefer group fitness classes or personal training sessions? <post|>, <post|>What's your go-to healthy meal after a workout? <post|>, <post|>How important is technology in your fitness routine, like wearables or fitness apps? <post|> <post|>Cycling paths around the city for a scenic and invigorating ride. <post|>, <post|>A health and wellness seminar or workshop hosted at a community center. <post|>, <post|>An organic grocery store for a shopping trip focused on wholesome foods. <post|>, <post|>Local gym for a fresh morning workout session. <post|>, <post|>Weekend hiking trails in the regional park for a blend of fitness and nature. <post|>, <post|>Fitness boot camps that take place at the central sports complex. <post|>, <post|>Local swimming pool for some laps to help with cardio and strength. <post|>, <post|>The health-oriented cafe downtown that serves protein-packed smoothies and organic meals. <post|>, <post|>Community yoga classes held in the nearby park. <post|>, <post|>The newly opened fitness center that offers a variety of classes from spin to pilates. <post|>